Lineage for d1q8sb_ (1q8s B:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Legume lectin [49904] (23 species) 
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries) 
Domain d1q8sb_: 1q8s B: [96228]
Details for d1q8sb_
PDB Entry: 1q8s (more details), 2.05 Å
PDB Description: pterocarpus angolensis lectin (pal) in complex with the dimannoside man(alpha1-6)man
SCOP Domain Sequences for d1q8sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8sb_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis)}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a
SCOP Domain Coordinates for d1q8sb_:
Click to download the PDB-style file with coordinates for d1q8sb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q8sb_:
- d1q8sb_ first appeared in SCOP 1.67
- d1q8sb_ appears in SCOP 1.71
- d1q8sb_ appears in the current release, SCOPe 2.08
View in 3D
