Lineage for d1q8ra_ (1q8r A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414418Superfamily d.79.6: Holliday junction resolvase RusA [103084] (1 family) (S)
  5. 414419Family d.79.6.1: Holliday junction resolvase RusA [103085] (1 protein)
  6. 414420Protein Holliday junction resolvase RusA [103086] (1 species)
  7. 414421Species Escherichia coli [TaxId:562] [103087] (1 PDB entry)
  8. 414422Domain d1q8ra_: 1q8r A: [96225]

Details for d1q8ra_

PDB Entry: 1q8r (more details), 1.9 Å

PDB Description: Structure of E.coli RusA Holliday junction resolvase

SCOP Domain Sequences for d1q8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ra_ d.79.6.1 (A:) Holliday junction resolvase RusA {Escherichia coli}
mntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkirie
chmpdrrrrdldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg

SCOP Domain Coordinates for d1q8ra_:

Click to download the PDB-style file with coordinates for d1q8ra_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q8rb_