![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.6: Holliday junction resolvase RusA [103084] (1 family) ![]() automatically mapped to Pfam PF05866 |
![]() | Family d.79.6.1: Holliday junction resolvase RusA [103085] (2 proteins) |
![]() | Protein Holliday junction resolvase RusA [103086] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103087] (1 PDB entry) |
![]() | Domain d1q8ra_: 1q8r A: [96225] |
PDB Entry: 1q8r (more details), 1.9 Å
SCOPe Domain Sequences for d1q8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8ra_ d.79.6.1 (A:) Holliday junction resolvase RusA {Escherichia coli [TaxId: 562]} mntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkirie chmpdrrrrdldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg
Timeline for d1q8ra_: