SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q8qa_ (1q8q A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042368Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)
  8. 2042379Domain d1q8qa_: 1q8q A: [96223]
    complexed with ca, mn

Details for d1q8qa_

PDB Entry: 1q8q (more details), 2.05 Å

PDB Description: Pterocarpus angolensis lectin (PAL) in complex with the dimannoside Man(alpha1-4)Man
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1q8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8qa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d1q8qa_:

Click to download the PDB-style file with coordinates for d1q8qa_.
(The format of our PDB-style files is described here.)

Timeline for d1q8qa_: