Lineage for d1q8pa_ (1q8p A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663305Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries)
  8. 663308Domain d1q8pa_: 1q8p A: [96221]

Details for d1q8pa_

PDB Entry: 1q8p (more details), 1.75 Å

PDB Description: Pterocarpus angolensis lectin PAL in complex with the dimannoside Man(alpha1-3)Man
PDB Compounds: (A:) lectin

SCOP Domain Sequences for d1q8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8pa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d1q8pa_:

Click to download the PDB-style file with coordinates for d1q8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1q8pa_: