Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (30 PDB entries) |
Domain d1q8ob_: 1q8o B: [96220] complexed with ca, man, mma, mn |
PDB Entry: 1q8o (more details), 2.2 Å
SCOP Domain Sequences for d1q8ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8ob_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt a
Timeline for d1q8ob_: