Lineage for d1q8ob_ (1q8o B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459934Protein Legume lectin [49904] (23 species)
  7. 459938Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)
  8. 459956Domain d1q8ob_: 1q8o B: [96220]

Details for d1q8ob_

PDB Entry: 1q8o (more details), 2.2 Å

PDB Description: pterocartpus angolensis lectin pal in complex with the dimmanoside man(alpha1-2)man

SCOP Domain Sequences for d1q8ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ob_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis)}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d1q8ob_:

Click to download the PDB-style file with coordinates for d1q8ob_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ob_: