SCOP 1.67: Domain d1q8ob_: 1q8o B:

Lineage for d1q8ob_ (1q8o B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)

8. Domain d1q8ob_: 1q8o B: [96220]
   complexed with ca, man, mma, mn

Details for d1q8ob_

PDB Entry: 1q8o, 2.2 Å

PDB Description: pterocartpus angolensis lectin pal in complex with the dimmanoside man(alpha1-2)man

SCOP Domain Sequences for d1q8ob_:

Sequence; same for both SEQRES and ATOM records:

>d1q8ob_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis)}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d1q8ob_:

• d1q8ob_ is new in SCOP 1.67
  
• d1q8ob_ appears in SCOP 1.69
  
• d1q8ob_ appears in the current release, SCOPe 2.08