Lineage for d1q8oa_ (1q8o A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555962Protein Legume lectin [49904] (23 species)
  7. 555966Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)
  8. 555983Domain d1q8oa_: 1q8o A: [96219]

Details for d1q8oa_

PDB Entry: 1q8o (more details), 2.2 Å

PDB Description: pterocartpus angolensis lectin pal in complex with the dimmanoside man(alpha1-2)man

SCOP Domain Sequences for d1q8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8oa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis)}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d1q8oa_:

Click to download the PDB-style file with coordinates for d1q8oa_.
(The format of our PDB-style files is described here.)

Timeline for d1q8oa_: