Lineage for d1q8md_ (1q8m D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364344Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (1 species)
  7. 364345Species Human (Homo sapiens) [TaxId:9606] [101507] (1 PDB entry)
  8. 364349Domain d1q8md_: 1q8m D: [96218]
    complexed with gsh, so4

Details for d1q8md_

PDB Entry: 1q8m (more details), 2.6 Å

PDB Description: crystal structure of the human myeloid cell activating receptor trem-1

SCOP Domain Sequences for d1q8md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8md_ b.1.1.1 (D:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens)}
melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
e

SCOP Domain Coordinates for d1q8md_:

Click to download the PDB-style file with coordinates for d1q8md_.
(The format of our PDB-style files is described here.)

Timeline for d1q8md_: