Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries) Uniprot Q9NP99 21-133 |
Domain d1q8mc1: 1q8m C:16-134 [96217] Other proteins in same PDB: d1q8ma2, d1q8mb2, d1q8mc2, d1q8md2 complexed with gsh, so4 |
PDB Entry: 1q8m (more details), 2.6 Å
SCOPe Domain Sequences for d1q8mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8mc1 b.1.1.1 (C:16-134) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvt
Timeline for d1q8mc1: