Lineage for d1q8la_ (1q8l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910056Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 protein domains)
  6. 1910127Protein Menkes copper-transporting ATPase [55012] (1 species)
  7. 1910128Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries)
  8. 1910131Domain d1q8la_: 1q8l A: [96214]
    2nd metal-binding domain

Details for d1q8la_

PDB Entry: 1q8l (more details)

PDB Description: Second Metal Binding Domain of the Menkes ATPase
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1q8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
gsmaqagevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisv
eemkkqieamgfpafvkkqpkylk

SCOPe Domain Coordinates for d1q8la_:

Click to download the PDB-style file with coordinates for d1q8la_.
(The format of our PDB-style files is described here.)

Timeline for d1q8la_: