Lineage for d1q8ja2 (1q8j A:1-300)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476868Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 476869Family c.1.26.1: Homocysteine S-methyltransferase [82283] (2 proteins)
    Pfam 02574
  6. 476881Protein Cobalamin-dependent methionine synthase MetH, N-terminal domain [102108] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 476882Species Thermotoga maritima [TaxId:243274] [102109] (6 PDB entries)
  8. 476887Domain d1q8ja2: 1q8j A:1-300 [96211]
    Other proteins in same PDB: d1q8ja1, d1q8jb1

Details for d1q8ja2

PDB Entry: 1q8j (more details), 1.9 Å

PDB Description: cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex)

SCOP Domain Sequences for d1q8ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ja2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima}
mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri

SCOP Domain Coordinates for d1q8ja2:

Click to download the PDB-style file with coordinates for d1q8ja2.
(The format of our PDB-style files is described here.)

Timeline for d1q8ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q8ja1