Lineage for d1q8ja1 (1q8j A:301-559)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840322Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2840464Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 2840465Protein Cobalamin-dependent methionine synthase MetH, C-terminal domain [102104] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 2840466Species Thermotoga maritima [TaxId:2336] [102105] (8 PDB entries)
  8. 2840475Domain d1q8ja1: 1q8j A:301-559 [96210]
    Other proteins in same PDB: d1q8ja2, d1q8jb2
    complexed with c2f, cd, hcs

Details for d1q8ja1

PDB Entry: 1q8j (more details), 1.9 Å

PDB Description: cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex)
PDB Compounds: (A:) 5-methyltetrahydrofolate S-homocysteine methyltransferase

SCOPe Domain Sequences for d1q8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ja1 c.1.21.2 (A:301-559) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
detlmktlnatlvilekke

SCOPe Domain Coordinates for d1q8ja1:

Click to download the PDB-style file with coordinates for d1q8ja1.
(The format of our PDB-style files is described here.)

Timeline for d1q8ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q8ja2