![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
![]() | Species Escherichia coli [TaxId:562] [102482] (1 PDB entry) DNA polymerase II, additional N-terminal subdomain has an OB-fold with a ferredoxin-like fold insertion |
![]() | Domain d1q8ia1: 1q8i A:2-389 [96208] Other proteins in same PDB: d1q8ia2 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1q8i (more details), 2 Å
SCOPe Domain Sequences for d1q8ia1:
Sequence, based on SEQRES records: (download)
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} aqagfiltrhwrdtpqgtevsfwlatdngplqvtlapqesvafipadqvpraqhilqgeq gfrltplalkdfhrqpvyglycrahrqlmnyekrlreggvtvyeadvrpperylmerfit spvwvegdmhngtivnarlkphpdyrpplkwvsidiettrhgelyciglegcgqrivyml gpengdassldfeleyvasrpqlleklnawfanydpdviigwnvvqfdlrmlqkhaeryr lplrlgrdnselewrehgfkngvffaqakgrliidgiealksafwnfssfsletvaqell gegksidnpwdrmdeidrrfaedkpalatynlkdcelvtqifhkteimpflleratvngl pvdrhggsvaafghlyfprmhragyvap
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} aqagfiltrhwrdtpqgtevsfwlatdngplqvtlapqesvafipadqvpraqhilqgeq gfrltplalkdfhrqpvyglycrahrqlmnyekrlreggvtvyeadvrpperylmerfit spvwvegdmhngtivnarlkphpdyrpplkwvsidiettrhgelyciglegcgqrivyml gpengdassldfeleyvasrpqlleklnawfanydpdviigwnvvqfdlrmlqkhaeryr lplrlgrdnselewrehgfkngvffaqakgrliidgiealksafwnfssfsletvaqell mdeidrrfaedkpalatynlkdcelvtqifhkteimpflleratvnglpvdrhggsvaaf ghlyfprmhragyvap
Timeline for d1q8ia1: