Lineage for d1q8ia1 (1q8i A:2-389)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124346Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2124487Species Escherichia coli [TaxId:562] [102482] (1 PDB entry)
    DNA polymerase II, additional N-terminal subdomain has an OB-fold with a ferredoxin-like fold insertion
  8. 2124488Domain d1q8ia1: 1q8i A:2-389 [96208]
    Other proteins in same PDB: d1q8ia2

Details for d1q8ia1

PDB Entry: 1q8i (more details), 2 Å

PDB Description: crystal structure of escherichia coli dna polymerase ii
PDB Compounds: (A:) DNA polymerase II

SCOPe Domain Sequences for d1q8ia1:

Sequence, based on SEQRES records: (download)

>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]}
aqagfiltrhwrdtpqgtevsfwlatdngplqvtlapqesvafipadqvpraqhilqgeq
gfrltplalkdfhrqpvyglycrahrqlmnyekrlreggvtvyeadvrpperylmerfit
spvwvegdmhngtivnarlkphpdyrpplkwvsidiettrhgelyciglegcgqrivyml
gpengdassldfeleyvasrpqlleklnawfanydpdviigwnvvqfdlrmlqkhaeryr
lplrlgrdnselewrehgfkngvffaqakgrliidgiealksafwnfssfsletvaqell
gegksidnpwdrmdeidrrfaedkpalatynlkdcelvtqifhkteimpflleratvngl
pvdrhggsvaafghlyfprmhragyvap

Sequence, based on observed residues (ATOM records): (download)

>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]}
aqagfiltrhwrdtpqgtevsfwlatdngplqvtlapqesvafipadqvpraqhilqgeq
gfrltplalkdfhrqpvyglycrahrqlmnyekrlreggvtvyeadvrpperylmerfit
spvwvegdmhngtivnarlkphpdyrpplkwvsidiettrhgelyciglegcgqrivyml
gpengdassldfeleyvasrpqlleklnawfanydpdviigwnvvqfdlrmlqkhaeryr
lplrlgrdnselewrehgfkngvffaqakgrliidgiealksafwnfssfsletvaqell
mdeidrrfaedkpalatynlkdcelvtqifhkteimpflleratvnglpvdrhggsvaaf
ghlyfprmhragyvap

SCOPe Domain Coordinates for d1q8ia1:

Click to download the PDB-style file with coordinates for d1q8ia1.
(The format of our PDB-style files is described here.)

Timeline for d1q8ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q8ia2