Lineage for d1q8ha_ (1q8h A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891973Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 891974Superfamily g.32.1: GLA-domain [57630] (1 family) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 891975Family g.32.1.1: GLA-domain [57631] (6 proteins)
  6. 892017Protein Osteocalcin [103594] (2 species)
  7. 892020Species Pig (Sus scrofa) [TaxId:9823] [103596] (1 PDB entry)
  8. 892021Domain d1q8ha_: 1q8h A: [96207]
    complexed with ca

Details for d1q8ha_

PDB Entry: 1q8h (more details), 2 Å

PDB Description: crystal structure of porcine osteocalcin
PDB Compounds: (A:) Osteocalcin

SCOP Domain Sequences for d1q8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ha_ g.32.1.1 (A:) Osteocalcin {Pig (Sus scrofa) [TaxId: 9823]}
pdpleprrevcelnpdcdeladhigfqeayrrfygia

SCOP Domain Coordinates for d1q8ha_:

Click to download the PDB-style file with coordinates for d1q8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ha_: