SCOPe 2.08: Domain d1q8ha_: 1q8h A:

Lineage for d1q8ha_ (1q8h A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.32: GLA-domain [57629] (1 superfamily)
   Calcium ion-bound

4. Superfamily g.32.1: GLA-domain [57630] (2 families)
   gamma-carboxy-glutamic acid-rich domain

5. Family g.32.1.1: GLA-domain [57631] (7 proteins)
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
   

6. Protein Osteocalcin [103594] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [103596] (1 PDB entry)

8. Domain d1q8ha_: 1q8h A: [96207]
   complexed with ca

Details for d1q8ha_

PDB Entry: 1q8h, 2 Å

PDB Description: crystal structure of porcine osteocalcin

PDB Compounds: (A:) Osteocalcin

SCOPe Domain Sequences for d1q8ha_:

Sequence; same for both SEQRES and ATOM records:

>d1q8ha_ g.32.1.1 (A:) Osteocalcin {Pig (Sus scrofa) [TaxId: 9823]}
pdpleprrevcelnpdcdeladhigfqeayrrfygia

Timeline for d1q8ha_:

• d1q8ha_ first appeared in SCOP 1.67
  
• d1q8ha_ appears in SCOPe 2.07