Lineage for d1q8fd_ (1q8f D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401344Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 401345Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family) (S)
  5. 401346Family c.70.1.1: Nucleoside hydrolase [53591] (4 proteins)
  6. 401373Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species)
  7. 401374Species Escherichia coli [TaxId:562] [102634] (1 PDB entry)
  8. 401378Domain d1q8fd_: 1q8f D: [96206]
    complexed with ca, gol

Details for d1q8fd_

PDB Entry: 1q8f (more details), 1.7 Å

PDB Description: Crystal Structure of the E.coli pyrimidine nucleoside hydrolase yeiK

SCOP Domain Sequences for d1q8fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8fd_ c.70.1.1 (D:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli}
krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat
cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv
eecvrgyi

SCOP Domain Coordinates for d1q8fd_:

Click to download the PDB-style file with coordinates for d1q8fd_.
(The format of our PDB-style files is described here.)

Timeline for d1q8fd_: