SCOPe 2.07: Domain d1q8fc_: 1q8f C:

Lineage for d1q8fc_ (1q8f C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
   core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest

4. Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families)

5. Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
   automatically mapped to Pfam PF01156

6. Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species)

7. Species Escherichia coli [TaxId:562] [102634] (3 PDB entries)

8. Domain d1q8fc_: 1q8f C: [96205]
   complexed with ca, gol

Details for d1q8fc_

PDB Entry: 1q8f, 1.7 Å

PDB Description: Crystal Structure of the E.coli pyrimidine nucleoside hydrolase yeiK

PDB Compounds: (C:) Pyrimidine nucleoside hydrolase

SCOPe Domain Sequences for d1q8fc_:

Sequence; same for both SEQRES and ATOM records:

>d1q8fc_ c.70.1.1 (C:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]}
krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat
cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv
eecvrgyi

Timeline for d1q8fc_:

• d1q8fc_ first appeared in SCOP 1.67
  
• d1q8fc_ appears in SCOPe 2.06
  
• d1q8fc_ appears in the current release, SCOPe 2.08