![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) ![]() |
![]() | Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
![]() | Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102634] (3 PDB entries) |
![]() | Domain d1q8fc_: 1q8f C: [96205] complexed with ca, gol |
PDB Entry: 1q8f (more details), 1.7 Å
SCOPe Domain Sequences for d1q8fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8fc_ c.70.1.1 (C:) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]} krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv eecvrgyi
Timeline for d1q8fc_: