Lineage for d1q8ca_ (1q8c A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001724Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2001725Superfamily a.79.1: NusB-like [48013] (3 families) (S)
  5. 2001751Family a.79.1.2: Hypothetical protein MG027 [101303] (1 protein)
    automatically mapped to Pfam PF09185
  6. 2001752Protein Hypothetical protein MG027 [101304] (1 species)
  7. 2001753Species Mycoplasma genitalium [TaxId:2097] [101305] (1 PDB entry)
  8. 2001754Domain d1q8ca_: 1q8c A: [96202]
    structural genomics
    complexed with cl, iod, na

Details for d1q8ca_

PDB Entry: 1q8c (more details), 2 Å

PDB Description: A conserved hypothetical protein from Mycoplasma genitalium shows structural homology to NusB proteins
PDB Compounds: (A:) Hypothetical protein MG027

SCOPe Domain Sequences for d1q8ca_:

Sequence, based on SEQRES records: (download)

>d1q8ca_ a.79.1.2 (A:) Hypothetical protein MG027 {Mycoplasma genitalium [TaxId: 2097]}
ltrtqrriavvefifsllfflpkeaeviqadfleydtkerqlnewqklivkafsenifsf
qkkieeqqlknqleiqtkynkisgkkidllttavvlcalseqkahntdkplliseallim
dhysqgaekkqthalldkll

Sequence, based on observed residues (ATOM records): (download)

>d1q8ca_ a.79.1.2 (A:) Hypothetical protein MG027 {Mycoplasma genitalium [TaxId: 2097]}
ltrtqrriavvefifsllfflpkeaeviqadfleydtkerqlnewqklivkafsenifsf
qkkieeqqlknqleiqtkidllttavvlcalseqkahntdkplliseallimdhysqgae
kkqthalldkll

SCOPe Domain Coordinates for d1q8ca_:

Click to download the PDB-style file with coordinates for d1q8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ca_: