Lineage for d1q88b1 (1q88 B:148-341)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574628Fold e.47: 39 kda initiator binding protein, IBP39, C-terminal domains [103408] (1 superfamily)
    2 closely associated domains: (1) all-alpha, EF-hand like; (2) alpha+beta, Frataxin-like
  4. 2574629Superfamily e.47.1: 39 kda initiator binding protein, IBP39, C-terminal domains [103409] (1 family) (S)
    automatically mapped to Pfam PF11422
  5. 2574630Family e.47.1.1: 39 kda initiator binding protein, IBP39, C-terminal domains [103410] (1 protein)
  6. 2574631Protein 39 kda initiator binding protein, IBP39, C-terminal domains [103411] (1 species)
  7. 2574632Species Trichomonas vaginalis [TaxId:5722] [103412] (3 PDB entries)
  8. 2574634Domain d1q88b1: 1q88 B:148-341 [96195]
    Other proteins in same PDB: d1q88b2

Details for d1q88b1

PDB Entry: 1q88 (more details), 2.42 Å

PDB Description: Crystal structure of the C-domain of the T.vaginalis Inr binding protein, IBP39 (monoclinic form)
PDB Compounds: (B:) 39 kDa initiator binding protein

SCOPe Domain Sequences for d1q88b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q88b1 e.47.1.1 (B:148-341) 39 kda initiator binding protein, IBP39, C-terminal domains {Trichomonas vaginalis [TaxId: 5722]}
mcignstpneqetfrakvdeiwfrltqktdgtvmrdfliekaaeyfkqpeqpkqnaievi
saimapqeeqtkskadlykflamfgpyetimlkiaslllisnnkghwltfdpqaeknann
qrdsisgwfdqnepnclilktptgirkiwnkplieatgqylmdengekydswdkyfemkp
ietyltayptfapm

SCOPe Domain Coordinates for d1q88b1:

Click to download the PDB-style file with coordinates for d1q88b1.
(The format of our PDB-style files is described here.)

Timeline for d1q88b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q88b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1q88a_