SCOPe 2.07: Domain d1q86t_: 1q86 T:

Lineage for d1q86t_ (1q86 T:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
   Uniprot P12732

8. Domain d1q86t_: 1q86 T: [96185]
   Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, pha

Details for d1q86t_

PDB Entry: 1q86, 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

PDB Compounds: (T:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d1q86t_:

Sequence; same for both SEQRES and ATOM records:

>d1q86t_ d.12.1.1 (T:) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1q86t_:

• d1q86t_ first appeared in SCOP 1.67
  
• d1q86t_ appears in SCOPe 2.06
  
• d1q86t_ appears in the current release, SCOPe 2.08