SCOPe 2.06: Domain d1q86s_: 1q86 S:

Lineage for d1q86s_ (1q86 S:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
   Uniprot P10970

8. Domain d1q86s_: 1q86 S: [96184]
   Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, pha

Details for d1q86s_

PDB Entry: 1q86, 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

PDB Compounds: (S:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d1q86s_:

Sequence; same for both SEQRES and ATOM records:

>d1q86s_ d.55.1.1 (S:) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1q86s_:

• d1q86s_ first appeared in SCOP 1.67
  
• d1q86s_ appears in SCOPe 2.05
  
• d1q86s_ appears in SCOPe 2.07
  
• d1q86s_ appears in the current release, SCOPe 2.08