| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() automatically mapped to Pfam PF01280 |
| Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
| Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
| Domain d1q86q_: 1q86 Q: [96182] Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ protein/RNA complex; complexed with cd, cl, k, mg, na, pha |
PDB Entry: 1q86 (more details), 3 Å
SCOPe Domain Sequences for d1q86q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q86q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida
Timeline for d1q86q_:
View in 3DDomains from other chains: (mouse over for more information) d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ |