Lineage for d1q86n_ (1q86 N:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716501Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 716502Protein Ribosomal protein L15e [54194] (1 species)
  7. 716503Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries)
  8. 716542Domain d1q86n_: 1q86 N: [96179]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86n_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (N:) L15 Ribosomal Protein

SCOP Domain Sequences for d1q86n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86n_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1q86n_:

Click to download the PDB-style file with coordinates for d1q86n_.
(The format of our PDB-style files is described here.)

Timeline for d1q86n_: