| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
| Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
| Protein Ribosomal protein L10e [54688] (2 species) |
| Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries) Uniprot P60617 |
| Domain d1q86j_: 1q86 J: [96175] Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ protein/RNA complex; complexed with cd, cl, k, mg, na, pha |
PDB Entry: 1q86 (more details), 3 Å
SCOPe Domain Sequences for d1q86j_:
Sequence, based on SEQRES records: (download)
>d1q86j_ d.41.4.1 (J:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
>d1q86j_ d.41.4.1 (J:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna
Timeline for d1q86j_:
View in 3DDomains from other chains: (mouse over for more information) d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ |