Lineage for d1q86j_ (1q86 J:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721795Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 721932Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 721933Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 721934Protein Ribosomal protein L10e [54688] (1 species)
  7. 721935Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries)
  8. 721974Domain d1q86j_: 1q86 J: [96175]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86j_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (J:) L10 Ribosomal Protein

SCOP Domain Sequences for d1q86j_:

Sequence, based on SEQRES records: (download)

>d1q86j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1q86j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOP Domain Coordinates for d1q86j_:

Click to download the PDB-style file with coordinates for d1q86j_.
(The format of our PDB-style files is described here.)

Timeline for d1q86j_: