SCOPe 2.05: Domain d1q86i_: 1q86 I:

Lineage for d1q86i_ (1q86 I:)

1. Root: SCOPe 2.05

2. Class j: Peptides [58231] (129 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d1q86i_: 1q86 I: [96174]
   Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, pha

Details for d1q86i_

PDB Entry: 1q86, 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

PDB Compounds: (I:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1q86i_:

Sequence, based on SEQRES records:

>d1q86i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1q86i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1q86i_:

• d1q86i_ first appeared in SCOP 1.67
  
• d1q86i_ appears in SCOPe 2.04
  
• d1q86i_ appears in SCOPe 2.06
  
• d1q86i_ appears in the current release, SCOPe 2.08