Lineage for d1q86i_ (1q86 I:)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900578Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 900579Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 900580Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 900581Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 900582Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 900622Domain d1q86i_: 1q86 I: [96174]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86i_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (I:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d1q86i_:

Sequence, based on SEQRES records: (download)

>d1q86i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1q86i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1q86i_:

Click to download the PDB-style file with coordinates for d1q86i_.
(The format of our PDB-style files is described here.)

Timeline for d1q86i_: