Lineage for d1q86e_ (1q86 E:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691529Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 691530Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 691531Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 691532Protein Ribosomal protein L4 [52168] (2 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 691533Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (44 PDB entries)
  8. 691572Domain d1q86e_: 1q86 E: [96169]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86e_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (E:) 50S ribosomal protein L4E

SCOP Domain Sequences for d1q86e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86e_ c.22.1.1 (E:) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d1q86e_:

Click to download the PDB-style file with coordinates for d1q86e_.
(The format of our PDB-style files is described here.)

Timeline for d1q86e_: