![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) ![]() |
![]() | Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) |
![]() | Protein Ribosomal protein L37e [57834] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (19 PDB entries) |
![]() | Domain d1q862_: 1q86 2: [96163] Other proteins in same PDB: d1q861_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ complexed with cd, cl, k, mg, na, pha |
PDB Entry: 1q86 (more details), 3 Å
SCOP Domain Sequences for d1q862_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q862_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1q862_:
![]() Domains from other chains: (mouse over for more information) d1q861_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ |