SCOP 1.71: Domain d1q861_: 1q86 1:

Lineage for d1q861_ (1q86 1:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (19 PDB entries)

8. Domain d1q861_: 1q86 1: [96162]
   Other proteins in same PDB: d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
   complexed with cd, cl, k, mg, na, pha

Details for d1q861_

PDB Entry: 1q86, 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

SCOP Domain Sequences for d1q861_:

Sequence; same for both SEQRES and ATOM records:

>d1q861_ g.41.8.1 (1:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

Timeline for d1q861_:

• d1q861_ first appeared in SCOP 1.67
  
• d1q861_ appears in SCOP 1.69
  
• d1q861_ appears in SCOP 1.73
  
• d1q861_ appears in the current release, SCOPe 2.08