Lineage for d1q85a2 (1q85 A:1-300)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1826444Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 1826445Family c.1.26.1: Homocysteine S-methyltransferase [82283] (3 proteins)
    Pfam PF02574
  6. 1826457Protein Cobalamin-dependent methionine synthase MetH, N-terminal domain [102108] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 1826458Species Thermotoga maritima [TaxId:2336] [102109] (8 PDB entries)
  8. 1826471Domain d1q85a2: 1q85 A:1-300 [96159]
    Other proteins in same PDB: d1q85a1, d1q85b1
    complexed with cd

Details for d1q85a2

PDB Entry: 1q85 (more details), 2 Å

PDB Description: cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met)
PDB Compounds: (A:) 5-methyltetrahydrofolate S-homocysteine methyltransferase

SCOPe Domain Sequences for d1q85a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q85a2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri

SCOPe Domain Coordinates for d1q85a2:

Click to download the PDB-style file with coordinates for d1q85a2.
(The format of our PDB-style files is described here.)

Timeline for d1q85a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q85a1