SCOP 1.67: Domain d1q82z_: 1q82 Z:

Lineage for d1q82z_ (1q82 Z:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (18 PDB entries)

8. Domain d1q82z_: 1q82 Z: [96153]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q82z_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82z_:

Sequence; same for both SEQRES and ATOM records:

>d1q82z_ c.9.2.1 (Z:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1q82z_:

• d1q82z_ is new in SCOP 1.67
  
• d1q82z_ appears in SCOP 1.69
  
• d1q82z_ appears in the current release, SCOPe 2.08