SCOPe 2.05: Domain d1q82y_: 1q82 Y:

Lineage for d1q82y_ (1q82 Y:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)
   automatically mapped to Pfam PF01198

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
   Uniprot P18138

8. Domain d1q82y_: 1q82 Y: [96152]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82y_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

PDB Compounds: (Y:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1q82y_:

Sequence; same for both SEQRES and ATOM records:

>d1q82y_ d.29.1.1 (Y:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1q82y_:

• d1q82y_ first appeared in SCOP 1.67
  
• d1q82y_ appears in SCOPe 2.04
  
• d1q82y_ appears in SCOPe 2.06
  
• d1q82y_ appears in the current release, SCOPe 2.08