SCOP 1.67: Domain d1q82x_: 1q82 X:

Lineage for d1q82x_ (1q82 X:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (18 PDB entries)

8. Domain d1q82x_: 1q82 X: [96151]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82y_, d1q82z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q82x_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82x_:

Sequence; same for both SEQRES and ATOM records:

>d1q82x_ d.59.1.1 (X:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1q82x_:

• d1q82x_ is new in SCOP 1.67
  
• d1q82x_ appears in SCOP 1.69
  
• d1q82x_ appears in the current release, SCOPe 2.08