![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein) |
![]() | Protein Ribosomal protein L24e [57750] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries) Uniprot P14116 |
![]() | Domain d1q82v_: 1q82 V: [96149] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ protein/RNA complex; complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOPe Domain Sequences for d1q82v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q82v_ g.39.1.6 (V:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]} recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d1q82v_:
![]() Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |