SCOP 1.67: Domain d1q82v_: 1q82 V:

Lineage for d1q82v_ (1q82 V:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (18 PDB entries)

8. Domain d1q82v_: 1q82 V: [96149]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q82v_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82v_:

Sequence; same for both SEQRES and ATOM records:

>d1q82v_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1q82v_:

• d1q82v_ is new in SCOP 1.67
  
• d1q82v_ appears in SCOP 1.69
  
• d1q82v_ appears in the current release, SCOPe 2.08