Lineage for d1q82u_ (1q82 U:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372810Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 372811Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 372832Protein Ribosomal proteins L24 (L24p) [50106] (1 species)
  7. 372833Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (18 PDB entries)
  8. 372840Domain d1q82u_: 1q82 U: [96148]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q82u_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d1q82u_:

Click to download the PDB-style file with coordinates for d1q82u_.
(The format of our PDB-style files is described here.)

Timeline for d1q82u_: