SCOP 1.69: Domain d1q82t_: 1q82 T:

Lineage for d1q82t_ (1q82 T:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (19 PDB entries)

8. Domain d1q82t_: 1q82 T: [96147]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_

Details for d1q82t_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82t_:

Sequence; same for both SEQRES and ATOM records:

>d1q82t_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1q82t_:

• d1q82t_ first appeared in SCOP 1.67
  
• d1q82t_ appears in SCOP 1.71
  
• d1q82t_ appears in the current release, SCOPe 2.08