Lineage for d1q82q_ (1q82 Q:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358614Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 358615Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 358616Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 358617Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 358618Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (18 PDB entries)
  8. 358625Domain d1q82q_: 1q82 Q: [96144]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q82q_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1q82q_:

Click to download the PDB-style file with coordinates for d1q82q_.
(The format of our PDB-style files is described here.)

Timeline for d1q82q_: