Lineage for d1q82p_ (1q82 P:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577755Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 577756Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 577757Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 577779Protein Ribosomal protein L18e [52084] (1 species)
  7. 577780Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (19 PDB entries)
  8. 577788Domain d1q82p_: 1q82 P: [96143]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q82p_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (P:)

SCOP Domain Sequences for d1q82p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82p_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1q82p_:

Click to download the PDB-style file with coordinates for d1q82p_.
(The format of our PDB-style files is described here.)

Timeline for d1q82p_: