SCOP 1.67: Domain d1q82k_: 1q82 K:

Lineage for d1q82k_ (1q82 K:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (2 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (18 PDB entries)

8. Domain d1q82k_: 1q82 K: [96138]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q82k_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82k_:

Sequence; same for both SEQRES and ATOM records:

>d1q82k_ c.21.1.1 (K:) Ribosomal protein L13 {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

Timeline for d1q82k_:

• d1q82k_ is new in SCOP 1.67
  
• d1q82k_ appears in SCOP 1.69
  
• d1q82k_ appears in the current release, SCOPe 2.08