![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
![]() | Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
![]() | Protein Ribosomal protein L10e [54688] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (19 PDB entries) |
![]() | Domain d1q82j_: 1q82 J: [96137] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOP Domain Sequences for d1q82j_:
Sequence, based on SEQRES records: (download)
>d1q82j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui} kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
>d1q82j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui} kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi fiawvnpdpnveeawrrakmkvtptinidsspagna
Timeline for d1q82j_:
![]() Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |