Lineage for d1q82i_ (1q82 I:)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2272904Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 2272905Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 2272906Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 2272907Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 2272908Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 2272939Domain d1q82i_: 1q82 I: [96136]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82i_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (I:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1q82i_:

Sequence, based on SEQRES records: (download)

>d1q82i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1q82i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1q82i_:

Click to download the PDB-style file with coordinates for d1q82i_.
(The format of our PDB-style files is described here.)

Timeline for d1q82i_: