Lineage for d1q82i_ (1q82 I:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529602Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 529603Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 529604Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 529605Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 529606Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (18 PDB entries)
  8. 529613Domain d1q82i_: 1q82 I: [96136]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_

Details for d1q82i_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82i_:

Sequence, based on SEQRES records: (download)

>d1q82i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1q82i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1q82i_:

Click to download the PDB-style file with coordinates for d1q82i_.
(The format of our PDB-style files is described here.)

Timeline for d1q82i_: