SCOP 1.67: Domain d1q82i_: 1q82 I:

Lineage for d1q82i_ (1q82 I:)

1. Root: SCOP 1.67

2. Class j: Peptides [58231] (111 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (17 PDB entries)

8. Domain d1q82i_: 1q82 I: [96136]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q82i_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82i_:

Sequence, based on SEQRES records:

>d1q82i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1q82i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1q82i_:

• d1q82i_ is new in SCOP 1.67
  
• d1q82i_ appears in SCOP 1.69
  
• d1q82i_ appears in the current release, SCOPe 2.08