![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (3 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (4 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (19 PDB entries) |
![]() | Domain d1q82h_: 1q82 H: [96135] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOP Domain Sequences for d1q82h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q82h_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui} pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
Timeline for d1q82h_:
![]() Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |