SCOP 1.67: Domain d1q82h_: 1q82 H:

Lineage for d1q82h_ (1q82 H:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (18 PDB entries)

8. Domain d1q82h_: 1q82 H: [96135]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q82h_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82h_:

Sequence; same for both SEQRES and ATOM records:

>d1q82h_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1q82h_:

• d1q82h_ is new in SCOP 1.67
  
• d1q82h_ appears in SCOP 1.69
  
• d1q82h_ appears in the current release, SCOPe 2.08