Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (2 species) duplication: consists of two domains of this fold |
Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (19 PDB entries) |
Domain d1q82g1: 1q82 G:1-79 [96133] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |
PDB Entry: 1q82 (more details), 2.98 Å
SCOP Domain Sequences for d1q82g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q82g1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui} prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms tigtfqshienmfhgvteg
Timeline for d1q82g1:
View in 3D Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |